PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 265aa    MW: 30415.1 Da    PI: 8.5992
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01401.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEde l ++v  +G g W ++a+  g++R++k+c+ rw++yl
       KHN01401.1 13 KGAWSREEDETLSKYVSIHGEGKWQKVAQNAGLKRCGKSCRQRWLNYL 60
                     79********************************************97 PP

2Myb_DNA-binding47.34.8e-1566110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  + +E++ +++++++lG++ W++Ia++++ gRt++++k++w++ 
       KHN01401.1  66 RGHISVDEEDMIIRLHRLLGNR-WALIAKRLP-GRTDNEIKNYWNTN 110
                      5666899***************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.622864IPR017930Myb domain
SuperFamilySSF466891.65E-2911107IPR009057Homeodomain-like
SMARTSM007172.8E-151262IPR001005SANT/Myb domain
PfamPF002493.3E-161360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-231467IPR009057Homeodomain-like
CDDcd001671.02E-101560No hitNo description
PROSITE profilePS5129420.58665115IPR017930Myb domain
SMARTSM007179.9E-1665113IPR001005SANT/Myb domain
PfamPF002494.2E-1466111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2368115IPR009057Homeodomain-like
CDDcd001675.09E-1170111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGRRPCCPKE INKGAWSREE DETLSKYVSI HGEGKWQKVA QNAGLKRCGK SCRQRWLNYL  60
KPGIKRGHIS VDEEDMIIRL HRLLGNRWAL IAKRLPGRTD NEIKNYWNTN LSRKLQKHPT  120
SSVSSLQHKR HEKEKTKQMH VAPEAPRRRR VNAVEYSKNL ENGGCGNRPS TTPSPSNIEE  180
GSSEEASFSD FLMDIDQIDD SNSKVPQKEE DHHHNKVELI TNNSPSSSSL SDHCHHLLPE  240
KFDPFETFLD VELQRMASFL GVEND
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271011524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2359131e-180AC235913.2 Glycine max clone GM_WBc0225O09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528497.10.0PREDICTED: transcription repressor MYB6
TrEMBLA0A0B2NW750.0A0A0B2NW75_GLYSO; Anthocyanin regulatory C1 protein
TrEMBLI1KHA70.0I1KHA7_SOYBN; Uncharacterized protein
STRINGGLYMA07G04210.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF153551012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.13e-54MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]